SCOPe 2.06: Domain d4ls6b1: 4ls6 B:1-250

Lineage for d4ls6b1 (4ls6 B:1-250)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries)

8. Domain d4ls6b1: 4ls6 B:1-250 [238180]
   automated match to d3u0fa1
   complexed with cl, gol, k; mutant

Details for d4ls6b1

PDB Entry: 4ls6, 1.56 Å

PDB Description: Crystal structure of beta-ketoacyl-ACP synthase II (FabF) I108F mutant from Bacillus subtilis

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ls6b1:

Sequence; same for both SEQRES and ATOM records:

>d4ls6b1 c.95.1.0 (B:1-250) automated matches {Bacillus subtilis [TaxId: 224308]}
tkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnved
ymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgfggletlesqfei
fltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqrg
dadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivle
elehalarga

Timeline for d4ls6b1:

• d4ls6b1 first appeared in SCOPe 2.03
  
• d4ls6b1 appears in SCOPe 2.05
  
• d4ls6b1 appears in SCOPe 2.07
  
• d4ls6b1 appears in the current release, SCOPe 2.08