SCOPe 2.03: Domain d1hgee_: 1hge E:

Lineage for d1hgee_ (1hge E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)

8. Domain d1hgee_: 1hge E: [23818]
   Other proteins in same PDB: d1hgeb_, d1hged_, d1hgef_
   complexed with mna, nag

Details for d1hgee_

PDB Entry: 1hge, 2.6 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (E:) hemagglutinin, (g135r), ha1 chain

SCOPe Domain Sequences for d1hgee_:

Sequence; same for both SEQRES and ATOM records:

>d1hgee_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqngrsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d1hgee_:

• d1hgee_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgee_ appears in SCOPe 2.02
  
• d1hgee_ appears in SCOPe 2.04
  
• d1hgee_ appears in the current release, SCOPe 2.08