SCOPe 2.03: Domain d4ls5a1: 4ls5 A:0-250

Lineage for d4ls5a1 (4ls5 A:0-250)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [238173] (2 PDB entries)

8. Domain d4ls5a1: 4ls5 A:0-250 [238174]
   automated match to d3u0fa1
   complexed with gol, k

Details for d4ls5a1

PDB Entry: 4ls5, 1.8 Å

PDB Description: Crystal structure of beta-ketoacyl-ACP synthase II (FabF) from Bacillus subtilis

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ls5a1:

Sequence; same for both SEQRES and ATOM records:

>d4ls5a1 c.95.1.0 (A:0-250) automated matches {Bacillus subtilis [TaxId: 224308]}
mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve
dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe
ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr
gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl
eelehalarga

Timeline for d4ls5a1:

• d4ls5a1 is new in SCOPe 2.03-stable
  
• d4ls5a1 appears in SCOPe 2.04
  
• d4ls5a1 appears in the current release, SCOPe 2.08