SCOPe 2.03: Domain d4lmyb_: 4lmy B:

Lineage for d4lmyb_ (4lmy B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries)

8. Domain d4lmyb_: 4lmy B: [238172]
   automated match to d4i7hb_
   complexed with zn

Details for d4lmyb_

PDB Entry: 4lmy, 1.6 Å

PDB Description: Structure of GAS PerR-Zn-Zn

PDB Compounds: (B:) Peroxide stress regulator PerR, FUR family

SCOPe Domain Sequences for d4lmyb_:

Sequence; same for both SEQRES and ATOM records:

>d4lmyb_ a.4.5.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 198466]}
mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
iakeaheqtgykvtripviaygicpdcqakdqpdfle

Timeline for d4lmyb_:

• d4lmyb_ is new in SCOPe 2.03-stable
  
• d4lmyb_ appears in SCOPe 2.04
  
• d4lmyb_ appears in the current release, SCOPe 2.08, called d4lmyb1