Lineage for d4lmyb_ (4lmy B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260317Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries)
  8. 1260319Domain d4lmyb_: 4lmy B: [238172]
    automated match to d4i7hb_
    complexed with zn

Details for d4lmyb_

PDB Entry: 4lmy (more details), 1.6 Å

PDB Description: Structure of GAS PerR-Zn-Zn
PDB Compounds: (B:) Peroxide stress regulator PerR, FUR family

SCOPe Domain Sequences for d4lmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmyb_ a.4.5.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 198466]}
mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
iakeaheqtgykvtripviaygicpdcqakdqpdfle

SCOPe Domain Coordinates for d4lmyb_:

Click to download the PDB-style file with coordinates for d4lmyb_.
(The format of our PDB-style files is described here.)

Timeline for d4lmyb_:

  • d4lmyb_ appears in periodic updates to SCOPe 2.03 starting on 2014-04-02
  • d4lmyb_ appears in SCOPe 2.04
  • d4lmyb_ appears in the current release, SCOPe 2.07, called d4lmyb1