SCOPe 2.08: Domain d4lmyb1: 4lmy B:1-155

Lineage for d4lmyb1 (4lmy B:1-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries)

8. Domain d4lmyb1: 4lmy B:1-155 [238172]
   Other proteins in same PDB: d4lmyb2
   automated match to d4i7hb_
   complexed with zn

Details for d4lmyb1

PDB Entry: 4lmy, 1.6 Å

PDB Description: Structure of GAS PerR-Zn-Zn

PDB Compounds: (B:) Peroxide stress regulator PerR, FUR family

SCOPe Domain Sequences for d4lmyb1:

Sequence; same for both SEQRES and ATOM records:

>d4lmyb1 a.4.5.0 (B:1-155) automated matches {Streptococcus pyogenes [TaxId: 198466]}
mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
iakeaheqtgykvtripviaygicpdcqakdqpdf

Timeline for d4lmyb1:

• d4lmyb1 first appeared in SCOPe 2.03, called d4lmyb_
  
• d4lmyb1 appears in SCOPe 2.07