Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries) |
Domain d4lmya_: 4lmy A: [238169] automated match to d4i7hb_ complexed with zn |
PDB Entry: 4lmy (more details), 1.6 Å
SCOPe Domain Sequences for d4lmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmya_ a.4.5.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 198466]} mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd iakeaheqtgykvtripviaygicpdcqa
Timeline for d4lmya_: