Lineage for d4jz2a2 (4jz2 A:121-230)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647961Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1647962Protein automated matches [226860] (25 species)
    not a true protein
  7. 1648008Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries)
  8. 1648010Domain d4jz2a2: 4jz2 A:121-230 [238156]
    Other proteins in same PDB: d4jz2a1
    automated match to d3tjta2
    complexed with co

Details for d4jz2a2

PDB Entry: 4jz2 (more details), 1.95 Å

PDB Description: Crystal structure of Co ion substituted SOD2 from Clostridium difficile
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4jz2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jz2a2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]}
ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds
pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl

SCOPe Domain Coordinates for d4jz2a2:

Click to download the PDB-style file with coordinates for d4jz2a2.
(The format of our PDB-style files is described here.)

Timeline for d4jz2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jz2a1