SCOPe 2.03: Domain d4jz2a1: 4jz2 A:29-120

Lineage for d4jz2a1 (4jz2 A:29-120)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries)

8. Domain d4jz2a1: 4jz2 A:29-120 [238155]
   Other proteins in same PDB: d4jz2a2
   automated match to d3tjta1
   complexed with co

Details for d4jz2a1

PDB Entry: 4jz2, 1.95 Å

PDB Description: Crystal structure of Co ion substituted SOD2 from Clostridium difficile

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4jz2a1:

Sequence; same for both SEQRES and ATOM records:

>d4jz2a1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]}
nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
nldslpkdiattvrnnaggaynhkfffdimtp

Timeline for d4jz2a1:

• d4jz2a1 is new in SCOPe 2.03-stable
  
• d4jz2a1 appears in SCOPe 2.04
  
• d4jz2a1 appears in the current release, SCOPe 2.08