SCOPe 2.04: Domain d4jyya2: 4jyy A:121-230

Lineage for d4jyya2 (4jyy A:121-230)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries)

8. Domain d4jyya2: 4jyy A:121-230 [238150]
   Other proteins in same PDB: d4jyya1
   automated match to d3tjta2
   complexed with azi, fe

Details for d4jyya2

PDB Entry: 4jyy, 2.1 Å

PDB Description: Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4jyya2:

Sequence; same for both SEQRES and ATOM records:

>d4jyya2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]}
ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds
pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl

Timeline for d4jyya2:

• d4jyya2 first appeared in SCOPe 2.03
  
• d4jyya2 appears in SCOPe 2.05
  
• d4jyya2 appears in the current release, SCOPe 2.08