SCOPe 2.05: Domain d4jyya1: 4jyy A:29-120

Lineage for d4jyya1 (4jyy A:29-120)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries)

8. Domain d4jyya1: 4jyy A:29-120 [238149]
   Other proteins in same PDB: d4jyya2
   automated match to d3tjta1
   complexed with azi, fe

Details for d4jyya1

PDB Entry: 4jyy, 2.1 Å

PDB Description: Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4jyya1:

Sequence; same for both SEQRES and ATOM records:

>d4jyya1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]}
nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
nldslpkdiattvrnnaggaynhkfffdimtp

Timeline for d4jyya1:

• d4jyya1 first appeared in SCOPe 2.03
  
• d4jyya1 appears in SCOPe 2.04
  
• d4jyya1 appears in SCOPe 2.06
  
• d4jyya1 appears in the current release, SCOPe 2.08