SCOPe 2.08: Domain d4jpfa1: 4jpf A:3-252

Lineage for d4jpfa1 (4jpf A:3-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [227637] (5 PDB entries)

8. Domain d4jpfa1: 4jpf A:3-252 [238146]
   automated match to d4b7va1
   complexed with 1lr, k, mg

Details for d4jpfa1

PDB Entry: 4jpf, 1.67 Å

PDB Description: structure of wild type pseudomonas aeruginosa fabf (kasii) in complex with ligand

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jpfa1:

Sequence; same for both SEQRES and ATOM records:

>d4jpfa1 c.95.1.0 (A:3-252) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rrrvvitgmgmlsplgldvpsswegilagrsgiapiehmdlsaystrfggsvkgfnveey
lsakearkldlfiqyglaasfqavrdsglevtdanrerigvsmgsgiggltnienncrsl
feqgprrispffvpgsiinmvsgflsihlglqgpnyalttacttgthsigmaarniayge
advmvaggsemaacglglggfgaaralstrndeptrasrpwdrdrdgfvlsdgsgalvle
elehararga

Timeline for d4jpfa1:

• d4jpfa1 first appeared in SCOPe 2.03
  
• d4jpfa1 appears in SCOPe 2.07