Lineage for d4jp1a_ (4jp1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356316Protein automated matches [190177] (7 species)
    not a true protein
  7. 1356365Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)
  8. 1356370Domain d4jp1a_: 4jp1 A: [238144]
    automated match to d4hnsa_
    complexed with mg

Details for d4jp1a_

PDB Entry: 4jp1 (more details), 2.46 Å

PDB Description: Mg2+ bound structure of Vibrio Cholerae CheY3
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4jp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jp1a_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
kife

SCOPe Domain Coordinates for d4jp1a_:

Click to download the PDB-style file with coordinates for d4jp1a_.
(The format of our PDB-style files is described here.)

Timeline for d4jp1a_:

  • d4jp1a_ appears in periodic updates to SCOPe 2.03 starting on 2014-04-02
  • d4jp1a_ appears in SCOPe 2.04
  • d4jp1a_ appears in the current release, SCOPe 2.07, called d4jp1a1