Lineage for d1hgfa_ (1hgf A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1305972Domain d1hgfa_: 1hgf A: [23813]
    Other proteins in same PDB: d1hgfb_, d1hgfd_, d1hgff_
    complexed with nag

Details for d1hgfa_

PDB Entry: 1hgf (more details), 3 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (A:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgfa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d1hgfa_:

Click to download the PDB-style file with coordinates for d1hgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1hgfa_: