SCOPe 2.05: Domain d4edwv_: 4edw V:

Lineage for d4edwv_ (4edw V:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57527] (5 PDB entries)
   Uniprot P01138

8. Domain d4edwv_: 4edw V: [238124]
   Other proteins in same PDB: d4edwl1, d4edwl2
   automated match to d1wwwv_
   complexed with gol

Details for d4edwv_

PDB Entry: 4edw, 2.48 Å

PDB Description: nerve growth factor in complex with fab from humanized version of mouse mab 911 (tanezumab)

PDB Compounds: (V:) Beta-nerve growth factor

SCOPe Domain Sequences for d4edwv_:

Sequence, based on SEQRES records:

>d4edwv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
hrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records):

>d4edwv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
hrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnvdgcr
gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Timeline for d4edwv_:

• d4edwv_ first appeared in SCOPe 2.03
  
• d4edwv_ appears in SCOPe 2.04
  
• d4edwv_ appears in SCOPe 2.06
  
• d4edwv_ appears in the current release, SCOPe 2.08