Lineage for d4edwv_ (4edw V:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703570Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 1703571Protein beta-Nerve growth factor [57525] (2 species)
  7. 1703572Species Human (Homo sapiens) [TaxId:9606] [57527] (5 PDB entries)
    Uniprot P01138
  8. 1703577Domain d4edwv_: 4edw V: [238124]
    Other proteins in same PDB: d4edwl1, d4edwl2
    automated match to d1wwwv_
    complexed with gol

Details for d4edwv_

PDB Entry: 4edw (more details), 2.48 Å

PDB Description: nerve growth factor in complex with fab from humanized version of mouse mab 911 (tanezumab)
PDB Compounds: (V:) Beta-nerve growth factor

SCOPe Domain Sequences for d4edwv_:

Sequence, based on SEQRES records: (download)

>d4edwv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
hrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsg
crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

Sequence, based on observed residues (ATOM records): (download)

>d4edwv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
hrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnvdgcr
gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk

SCOPe Domain Coordinates for d4edwv_:

Click to download the PDB-style file with coordinates for d4edwv_.
(The format of our PDB-style files is described here.)

Timeline for d4edwv_: