Lineage for d4edxv_ (4edx V:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260595Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2260596Protein beta-Nerve growth factor [57525] (2 species)
  7. 2260597Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries)
    Uniprot P01138
  8. 2260603Domain d4edxv_: 4edx V: [238123]
    Other proteins in same PDB: d4edxa1, d4edxa2, d4edxl1, d4edxl2
    automated match to d1wwww_

Details for d4edxv_

PDB Entry: 4edx (more details), 2.5 Å

PDB Description: Nerve Growth Factor in Complex with Fab from mouse mAb 911
PDB Compounds: (V:) Beta-nerve growth factor

SCOPe Domain Sequences for d4edxv_:

Sequence, based on SEQRES records: (download)

>d4edxv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgcr
gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

Sequence, based on observed residues (ATOM records): (download)

>d4edxv_ g.17.1.3 (V:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskh
wnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

SCOPe Domain Coordinates for d4edxv_:

Click to download the PDB-style file with coordinates for d4edxv_.
(The format of our PDB-style files is described here.)

Timeline for d4edxv_: