Lineage for d2virc_ (2vir C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108192Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 108193Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 108223Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 108224Protein Hemagglutinin [49824] (1 species)
  7. 108225Species Influenza A virus, different strains [TaxId:11320] [49825] (24 PDB entries)
  8. 108262Domain d2virc_: 2vir C: [23812]
    Other proteins in same PDB: d2vira1, d2vira2, d2virb1, d2virb2

Details for d2virc_

PDB Entry: 2vir (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d2virc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2virc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains}
vqssstgkicnnphrildgidctlidallgdphcdvfqdetwdlfverskafsncypydv
pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp
vldvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
tpdgsipndkpfqnvnkitygacpkyv

SCOP Domain Coordinates for d2virc_:

Click to download the PDB-style file with coordinates for d2virc_.
(The format of our PDB-style files is described here.)

Timeline for d2virc_: