SCOPe 2.06: Domain d3wi8a_: 3wi8 A:

Lineage for d3wi8a_ (3wi8 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)

8. Domain d3wi8a_: 3wi8 A: [238079]
   automated match to d1gjna_
   complexed with hnn, so4

Details for d3wi8a_

PDB Entry: 3wi8, 2.2 Å

PDB Description: Crystal structure of horse heart myoglobin reconstituted with manganese porphycene

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3wi8a_:

Sequence; same for both SEQRES and ATOM records:

>d3wi8a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgf

Timeline for d3wi8a_:

• d3wi8a_ first appeared in SCOPe 2.03
  
• d3wi8a_ appears in SCOPe 2.05
  
• d3wi8a_ appears in SCOPe 2.07
  
• d3wi8a_ appears in the current release, SCOPe 2.08