Lineage for d1hgha_ (1hgh A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531388Domain d1hgha_: 1hgh A: [23804]
    Other proteins in same PDB: d1hghb_, d1hghd_, d1hghf_
    complexed with mna, nag

Details for d1hgha_

PDB Entry: 1hgh (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (A:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgha_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d1hgha_:

Click to download the PDB-style file with coordinates for d1hgha_.
(The format of our PDB-style files is described here.)

Timeline for d1hgha_: