SCOPe 2.03: Domain d4nxjc_: 4nxj C:

Lineage for d4nxjc_ (4nxj C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [237857] (1 PDB entry)

8. Domain d4nxjc_: 4nxj C: [238033]
   automated match to d4nxjb_

Details for d4nxjc_

PDB Entry: 4nxj, 2.18 Å

PDB Description: crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum

PDB Compounds: (C:) Bromodomain protein

SCOPe Domain Sequences for d4nxjc_:

Sequence; same for both SEQRES and ATOM records:

>d4nxjc_ a.29.2.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymni

Timeline for d4nxjc_:

• d4nxjc_ is new in SCOPe 2.03-stable
  
• d4nxjc_ appears in SCOPe 2.04
  
• d4nxjc_ appears in the current release, SCOPe 2.08, called d4nxjc1