Lineage for d4nmhb_ (4nmh B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1346695Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1346799Species Mouse (Mus musculus) [TaxId:10090] [141879] (5 PDB entries)
    Uniprot P50172 24-298
  8. 1346815Domain d4nmhb_: 4nmh B: [238030]
    automated match to d3pdjb_
    complexed with 2kg, ndp, so4

Details for d4nmhb_

PDB Entry: 4nmh (more details), 2.9 Å

PDB Description: 11-beta-HSD1 in complex with a 3,3-Di-methyl-azetidin-2-one
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4nmhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nmhb_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
efrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaas
ahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnfl
syvvmstaalpmlkqsngsiavisslagkvtypmvapysaskfaldgffstirtelyitk
vnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydkspltp
illgnpgrkimeffslryynkdmf

SCOPe Domain Coordinates for d4nmhb_:

Click to download the PDB-style file with coordinates for d4nmhb_.
(The format of our PDB-style files is described here.)

Timeline for d4nmhb_: