Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.0: automated matches [227298] (1 protein) not a true family |
Protein automated matches [227124] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries) |
Domain d4nstb2: 4nst B:158-265 [238029] Other proteins in same PDB: d4nsta_, d4nstc_ automated match to d2pk2a1 protein/RNA complex; complexed with adp, af3, edo, mg |
PDB Entry: 4nst (more details), 2.2 Å
SCOPe Domain Sequences for d4nstb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nstb2 a.74.1.0 (B:158-265) automated matches {Human (Homo sapiens) [TaxId: 9606]} ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqm
Timeline for d4nstb2:
View in 3D Domains from other chains: (mouse over for more information) d4nsta_, d4nstc_, d4nstd1, d4nstd2 |