SCOPe 2.03: Domain d4ma3l1: 4ma3 L:1-112

Lineage for d4ma3l1 (4ma3 L:1-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Oryctolagus cuniculus, [TaxId:9986] [238018] (1 PDB entry)

8. Domain d4ma3l1: 4ma3 L:1-112 [238021]
   automated match to d3ngbc1
   complexed with act, so4

Details for d4ma3l1

PDB Entry: 4ma3, 2 Å

PDB Description: crystal structure of anti-hinge rabbit antibody c2095

PDB Compounds: (L:) C2095 light chain

SCOPe Domain Sequences for d4ma3l1:

Sequence; same for both SEQRES and ATOM records:

>d4ma3l1 b.1.1.0 (L:1-112) automated matches {Oryctolagus cuniculus, [TaxId: 9986]}
evltqtpssvsaavggtvtincqasqsvynknylawyqqkpgqppkrliysastlasgvs
srfkgsgsgtqftltisdvqcddvatyyclgsydcnraechafgggtkvvve

Timeline for d4ma3l1:

• d4ma3l1 is new in SCOPe 2.03-stable
  
• d4ma3l1 appears in SCOPe 2.04
  
• d4ma3l1 appears in the current release, SCOPe 2.08