Lineage for d4maul1 (4mau L:1-111)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520661Domain d4maul1: 4mau L:1-111 [238016]
    Other proteins in same PDB: d4maul2
    automated match to d1n0xl1
    complexed with fmt, gol, so4

Details for d4maul1

PDB Entry: 4mau (more details), 1.9 Å

PDB Description: Crystal structure of anti-ST2L antibody C2244
PDB Compounds: (L:) C2244 light chain

SCOPe Domain Sequences for d4maul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4maul1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslaislgqratiscrasksvstsgssymfwyqqkpgqppklliylasnles
gvparfsgsgsgtdftlnihpveeedaaayycqhsreipytfgggtkleik

SCOPe Domain Coordinates for d4maul1:

Click to download the PDB-style file with coordinates for d4maul1.
(The format of our PDB-style files is described here.)

Timeline for d4maul1: