Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mus musculus, [TaxId:10090] [237988] (4 PDB entries) |
Domain d4m7kl1: 4m7k L:1-113 [238012] Other proteins in same PDB: d4m7kl2 automated match to d1n0xl1 complexed with act, ca |
PDB Entry: 4m7k (more details), 1.9 Å
SCOPe Domain Sequences for d4m7kl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m7kl1 b.1.1.0 (L:1-113) automated matches {Mus musculus, [TaxId: 10090]} divmtqspssltvtagekvtmsckssqsllssgnqknyltwyqqipgqppklliywastr esgvpdrftgsgsgtdftltinsvqaedlavyycqndytypltfgagtklelk
Timeline for d4m7kl1: