SCOP 1.55: Domain d1hgja_: 1hgj A:

Lineage for d1hgja_ (1hgj A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)

4. Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families)

5. Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)

6. Protein Hemagglutinin [49824] (1 species)

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (18 PDB entries)

8. Domain d1hgja_: 1hgj A: [23801]
   Other proteins in same PDB: d1hgjb_, d1hgjd_, d1hgjf_

Details for d1hgja_

PDB Entry: 1hgj, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgja_:

Sequence; same for both SEQRES and ATOM records:

>d1hgja_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d1hgja_:

• d1hgja_ appears in SCOP 1.57
  
• d1hgja_ appears in the current release, SCOPe 2.08