Lineage for d4moya_ (4moy A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440574Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1440575Species Human (Homo sapiens) [TaxId:9606] [188651] (5 PDB entries)
  8. 1440584Domain d4moya_: 4moy A: [238009]
    automated match to d3e7ba_
    complexed with cl, gol, mn, po4

Details for d4moya_

PDB Entry: 4moy (more details), 2.2 Å

PDB Description: Structure of a second nuclear PP1 Holoenzyme, crystal form 1
PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4moya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4moya_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

SCOPe Domain Coordinates for d4moya_:

Click to download the PDB-style file with coordinates for d4moya_.
(The format of our PDB-style files is described here.)

Timeline for d4moya_: