Lineage for d4lrya_ (4lry A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395365Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 1395366Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 1395377Family c.119.1.2: DAK1 [109613] (3 proteins)
    Pfam PF02733
  6. 1395394Protein automated matches [191219] (2 species)
    not a true protein
  7. 1395411Species Escherichia coli [TaxId:83333] [236454] (1 PDB entry)
  8. 1395412Domain d4lrya_: 4lry A: [238003]
    automated match to d4lryb_
    complexed with gol

Details for d4lrya_

PDB Entry: 4lry (more details), 2.83 Å

PDB Description: crystal structure of the e.coli dhar(n)-dhak(t79l) complex
PDB Compounds: (A:) PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK

SCOPe Domain Sequences for d4lrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrya_ c.119.1.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmh
cgyigqgmlsgacpgeiflsptpdkifecamqvdggegvlliiknytgdilnfetatell
hdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrkl
nnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfssldqtvdemfd
tllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrl
ttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwgk

SCOPe Domain Coordinates for d4lrya_:

Click to download the PDB-style file with coordinates for d4lrya_.
(The format of our PDB-style files is described here.)

Timeline for d4lrya_: