Class a: All alpha proteins [46456] (284 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (34 PDB entries) |
Domain d4lm4b_: 4lm4 B: [237996] automated match to d4lkqb_ complexed with jpz, ni |
PDB Entry: 4lm4 (more details), 1.48 Å
SCOPe Domain Sequences for d4lm4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lm4b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp tepllkacrdnlsqwekvirgeetatw
Timeline for d4lm4b_: