Lineage for d1hgic_ (1hgi C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662496Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 662497Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 662542Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 662543Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 662544Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 662590Domain d1hgic_: 1hgi C: [23799]
    Other proteins in same PDB: d1hgib_, d1hgid_, d1hgif_

Details for d1hgic_

PDB Entry: 1hgi (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (C:) hemagglutinin, chain ha1

SCOP Domain Sequences for d1hgic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgic_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d1hgic_:

Click to download the PDB-style file with coordinates for d1hgic_.
(The format of our PDB-style files is described here.)

Timeline for d1hgic_: