SCOPe 2.06: Domain d4kq3l1: 4kq3 L:1-106

Lineage for d4kq3l1 (4kq3 L:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4kq3l1: 4kq3 L:1-106 [237978]
   Other proteins in same PDB: d4kq3l2
   automated match to d1n0xl1
   complexed with edo, gol, mes

Details for d4kq3l1

PDB Entry: 4kq3, 1.92 Å

PDB Description: crystal structure of anti-il-17a antibody cnto3186

PDB Compounds: (L:) CNTO3186 light chain

SCOPe Domain Sequences for d4kq3l1:

Sequence; same for both SEQRES and ATOM records:

>d4kq3l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspssvsasvgdrvtitcrasqgisnwlnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqysddptfgqgtkveik

Timeline for d4kq3l1:

• d4kq3l1 first appeared in SCOPe 2.03
  
• d4kq3l1 appears in SCOPe 2.05
  
• d4kq3l1 appears in SCOPe 2.07
  
• d4kq3l1 appears in the current release, SCOPe 2.08