SCOPe 2.03: Domain d4k8bb_: 4k8b B:

Lineage for d4k8bb_ (4k8b B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (5 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [189262] (2 PDB entries)

8. Domain d4k8bb_: 4k8b B: [237960]
   automated match to d1a1qa_
   complexed with 1rr, so4, zn

Details for d4k8bb_

PDB Entry: 4k8b, 2.8 Å

PDB Description: Crystal structure of HCV NS3/4A protease complexed with inhibitor

PDB Compounds: (B:) NS3 protease

SCOPe Domain Sequences for d4k8bb_:

Sequence; same for both SEQRES and ATOM records:

>d4k8bb_ b.47.1.3 (B:) automated matches {Hepatitis C virus [TaxId: 11103]}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

Timeline for d4k8bb_:

• d4k8bb_ is new in SCOPe 2.03-stable
  
• d4k8bb_ appears in SCOPe 2.04
  
• d4k8bb_ appears in the current release, SCOPe 2.08