SCOPe 2.03: Domain d4jr8a_: 4jr8 A:

Lineage for d4jr8a_ (4jr8 A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (3 families)

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (4 species)
   not a true protein

7. Species Haloarcula vallismortis [TaxId:28442] [237952] (1 PDB entry)

8. Domain d4jr8a_: 4jr8 A: [237953]
   automated match to d1s52a_
   complexed with 22b, ret

Details for d4jr8a_

PDB Entry: 4jr8, 2.3 Å

PDB Description: Crystal structure of cruxrhodopsin-3 from Haloarcula vallismortis at 2.3 angstrom resolution

PDB Compounds: (A:) Cruxrhodopsin-3

SCOPe Domain Sequences for d4jr8a_:

Sequence; same for both SEQRES and ATOM records:

>d4jr8a_ f.13.1.0 (A:) automated matches {Haloarcula vallismortis [TaxId: 28442]}
pegeaiwlwlgtagmflgmlyfiargwgetdsrrqkfyiatilitaiafvnylamalgfg
ltiveiageqrpiywarysdwlfttplllydlgllagadrntisslvsldvlmigtglva
tlsagsgvlsagaerlvwwgistafllvllyflfsslsgrvadlpsdtrstfktlrnlvt
vvwlvypvwwlvgtegiglvgigietagfmvidlvakvgfgiillrshgvldga

Timeline for d4jr8a_:

• d4jr8a_ is new in SCOPe 2.03-stable
  
• d4jr8a_ appears in SCOPe 2.04
  
• d4jr8a_ appears in the current release, SCOPe 2.08