SCOPe 2.03: Domain d4oj0a_: 4oj0 A:

Lineage for d4oj0a_ (4oj0 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)

8. Domain d4oj0a_: 4oj0 A: [237878]
   automated match to d3e5va_

Details for d4oj0a_

PDB Entry: 4oj0, 1.7 Å

PDB Description: mCardinal V218E

PDB Compounds: (A:) Fluorescent protein FP480

SCOPe Domain Sequences for d4oj0a_:

Sequence; same for both SEQRES and ATOM records:

>d4oj0a_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
eelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatc
fmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvkl
rgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrsk
kpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl

Timeline for d4oj0a_:

• d4oj0a_ is new in SCOPe 2.03-stable
  
• d4oj0a_ appears in SCOPe 2.04
  
• d4oj0a_ appears in the current release, SCOPe 2.08, called d4oj0a1