Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d4ocmf1: 4ocm F:7-122 [237873] Other proteins in same PDB: d4ocma_, d4ocmb_, d4ocmc2, d4ocmc3, d4ocmd_, d4ocme_, d4ocmf2, d4ocmf3 automated match to d4ocnc_ complexed with k, zn |
PDB Entry: 4ocm (more details), 1.99 Å
SCOPe Domain Sequences for d4ocmf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ocmf1 b.1.1.1 (F:7-122) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyyadsvk grftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
Timeline for d4ocmf1: