SCOPe 2.06: Domain d4nvpa1: 4nvp A:521-718

Lineage for d4nvpa1 (4nvp A:521-718)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries)

8. Domain d4nvpa1: 4nvp A:521-718 [237854]
   Other proteins in same PDB: d4nvpa2
   automated match to d3u11b_
   complexed with 7ch

Details for d4nvpa1

PDB Entry: 4nvp, 2.5 Å

PDB Description: Structure of the cyclic nucleotide-binding domain of HCN4 channel complexed with 7-CH-cAMP

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d4nvpa1:

Sequence; same for both SEQRES and ATOM records:

>d4nvpa1 b.82.3.2 (A:521-718) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkkn

Timeline for d4nvpa1:

• d4nvpa1 first appeared in SCOPe 2.03, called d4nvpa_
  
• d4nvpa1 was called d4nvpa_ in SCOPe 2.05
  
• d4nvpa1 appears in SCOPe 2.07
  
• d4nvpa1 appears in the current release, SCOPe 2.08