Lineage for d4nvpa_ (4nvp A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331405Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1331411Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1331546Protein automated matches [190352] (6 species)
    not a true protein
  7. 1331566Species Human (Homo sapiens) [TaxId:9606] [189505] (5 PDB entries)
  8. 1331571Domain d4nvpa_: 4nvp A: [237854]
    automated match to d3u11b_
    complexed with 7ch

Details for d4nvpa_

PDB Entry: 4nvp (more details), 2.5 Å

PDB Description: Structure of the cyclic nucleotide-binding domain of HCN4 channel complexed with 7-CH-cAMP
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d4nvpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nvpa_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelsepl
reeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqh
gvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeyp
mmrrafetvaldrldrigkkn

SCOPe Domain Coordinates for d4nvpa_:

Click to download the PDB-style file with coordinates for d4nvpa_.
(The format of our PDB-style files is described here.)

Timeline for d4nvpa_:

  • d4nvpa_ appears in periodic updates to SCOPe 2.03 starting on 2014-03-19
  • d4nvpa_ appears in SCOPe 2.04
  • d4nvpa_ appears in the current release, SCOPe 2.07, called d4nvpa1