SCOPe 2.03: Domain d4niyg_: 4niy G:

Lineage for d4niyg_ (4niy G:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein automated matches [191287] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [237072] (1 PDB entry)

8. Domain d4niyg_: 4niy G: [237844]
   Other proteins in same PDB: d4niya_, d4niyb_, d4niyc_, d4niyd_
   automated match to d4niye_
   complexed with ca, zn

Details for d4niyg_

PDB Entry: 4niy, 2.84 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) complexed to YRH-ecotin (M84Y/M85R/A86H ecotin)

PDB Compounds: (G:) ecotin

SCOPe Domain Sequences for d4niyg_:

Sequence, based on SEQRES records:

>d4niyg_ b.16.1.1 (G:) automated matches {Escherichia coli [TaxId: 83333]}
lekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktleg
wgydyyvfdkvsspvstyrhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvk
yrvwkaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d4niyg_ b.16.1.1 (G:) automated matches {Escherichia coli [TaxId: 83333]}
lekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktleg
wgydyyvfdkvsspvstyrhcpdkkekkfvtaylgdagmlrynsklpivvytpdnvdvky
rvwkaeekidnavvr

Timeline for d4niyg_:

• d4niyg_ is new in SCOPe 2.03-stable
  
• d4niyg_ appears in SCOPe 2.04
  
• d4niyg_ appears in the current release, SCOPe 2.08