Lineage for d4jnlu_ (4jnl U:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319957Protein automated matches [190044] (14 species)
    not a true protein
  7. 1319996Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries)
  8. 1320112Domain d4jnlu_: 4jnl U: [237824]
    automated match to d4h42u_
    complexed with pzh, so4

Details for d4jnlu_

PDB Entry: 4jnl (more details), 2 Å

PDB Description: crystal structure of upa in complex with its inhibitor 4- bromobenzylamine at ph 7.4
PDB Compounds: (U:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4jnlu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnlu_ b.47.1.2 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

SCOPe Domain Coordinates for d4jnlu_:

Click to download the PDB-style file with coordinates for d4jnlu_.
(The format of our PDB-style files is described here.)

Timeline for d4jnlu_: