SCOPe 2.03: Domain d4jala_: 4jal A:

Lineage for d4jala_ (4jal A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [234948] (2 PDB entries)

8. Domain d4jala_: 4jal A: [237816]
   automated match to d4jaka_
   complexed with edo, epe, sah

Details for d4jala_

PDB Entry: 4jal, 2 Å

PDB Description: Crystal structure of tRNA (Um34/Cm34) methyltransferase TrmL from Escherichia coli with SAH

PDB Compounds: (A:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4jala_:

Sequence; same for both SEQRES and ATOM records:

>d4jala_ c.116.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
malnivlyepeippntgniirlcantgfrlhiiepmgfawddkrlrragldyheftavtr
hhdyrafleaenpqrlfalttkgtpahsavsyqdgdylmfgpetrglpasildalpaeqk
iripmvpdsrsmnlsnavsvvvyeawrqlgypgavl

Timeline for d4jala_:

• d4jala_ is new in SCOPe 2.03-stable
  
• d4jala_ appears in SCOPe 2.04
  
• d4jala_ appears in the current release, SCOPe 2.08, called d4jala1