SCOPe 2.03: Domain d4hoeb_: 4hoe B:

Lineage for d4hoeb_ (4hoe B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)

8. Domain d4hoeb_: 4hoe B: [237807]
   automated match to d1aoea_
   complexed with 18g, gly, gol, ndp

Details for d4hoeb_

PDB Entry: 4hoe, 1.76 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 5-[3-(2,5-dimethoxy-4-phenylphenyl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine (UCP111E)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4hoeb_:

Sequence; same for both SEQRES and ATOM records:

>d4hoeb_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d4hoeb_:

• d4hoeb_ is new in SCOPe 2.03-stable
  
• d4hoeb_ appears in SCOPe 2.04
  
• d4hoeb_ appears in the current release, SCOPe 2.08