Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (12 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [237753] (1 PDB entry) |
Domain d3zq3d_: 3zq3 D: [237755] automated match to d1df3a_ |
PDB Entry: 3zq3 (more details), 2.8 Å
SCOPe Domain Sequences for d3zq3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zq3d_ b.60.1.1 (D:) automated matches {Rattus norvegicus [TaxId: 10116]} eeasfergnldvdklngdwfsivvasdkrekieengsmrvfvqhidvlenslgftfrike ngvctefslvadktakdgeyfveydgentftilktdydnyvmfhlvnvnngetfqlmely grtkdlssdikekfaklcvahgitrdniidltktdrclq
Timeline for d3zq3d_: