Lineage for d4ovda1 (4ovd A:61-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004528Species Atopobium parvulum [TaxId:521095] [237724] (1 PDB entry)
  8. 3004529Domain d4ovda1: 4ovd A:61-231 [237726]
    Other proteins in same PDB: d4ovda2
    automated match to d3equa1
    complexed with ca

Details for d4ovda1

PDB Entry: 4ovd (more details), 2 Å

PDB Description: crystal structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum dsm 20469
PDB Compounds: (A:) Peptidoglycan glycosyltransferase

SCOPe Domain Sequences for d4ovda1:

Sequence, based on SEQRES records: (download)

>d4ovda1 d.175.1.0 (A:61-231) automated matches {Atopobium parvulum [TaxId: 521095]}
ndivlharrgtiydrngnvlamsvdckdiyanpseikdastvaqviasflggspsdylgd
lqqdttfvyvrrrvdtdtaskiekalgekklkgiyfvnntkrvypygnvgvqilgfvnad
negasgleyyyndilagtnghmivetgaggtpiaggtsniteaqngqdivl

Sequence, based on observed residues (ATOM records): (download)

>d4ovda1 d.175.1.0 (A:61-231) automated matches {Atopobium parvulum [TaxId: 521095]}
ndivlharrgtiydrngnvlamsvdcknntkrvypygnvgvqilgfvnadnegasgleyy
yndilagtnghmisniteaqngqdivl

SCOPe Domain Coordinates for d4ovda1:

Click to download the PDB-style file with coordinates for d4ovda1.
(The format of our PDB-style files is described here.)

Timeline for d4ovda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ovda2