Lineage for d4olqc_ (4olq C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113235Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries)
  8. 2113244Domain d4olqc_: 4olq C: [237713]
    Other proteins in same PDB: d4olqa2, d4olqb2, d4olqd2, d4olqe2, d4olqf2
    automated match to d2ej5a_
    complexed with mlt, p6g, peg, pg4, unl

Details for d4olqc_

PDB Entry: 4olq (more details), 2.7 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium
PDB Compounds: (C:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4olqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4olqc_ c.14.1.0 (C:) automated matches {Hyphomonas neptunium [TaxId: 228405]}
lpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdvklilihggdagafa
agadisefetiyatedaakasgqriaqaldaiensekpviaaiegacvgggvslamaadl
rvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgriftageakslglidr
lvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpeaqslflngfanedf
kegyrafldkrpakftyr

SCOPe Domain Coordinates for d4olqc_:

Click to download the PDB-style file with coordinates for d4olqc_.
(The format of our PDB-style files is described here.)

Timeline for d4olqc_: