Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries) |
Domain d4olqc_: 4olq C: [237713] Other proteins in same PDB: d4olqa2, d4olqb2, d4olqd2, d4olqe2, d4olqf2 automated match to d2ej5a_ complexed with mlt, p6g, peg, pg4, unl |
PDB Entry: 4olq (more details), 2.7 Å
SCOPe Domain Sequences for d4olqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4olqc_ c.14.1.0 (C:) automated matches {Hyphomonas neptunium [TaxId: 228405]} lpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdvklilihggdagafa agadisefetiyatedaakasgqriaqaldaiensekpviaaiegacvgggvslamaadl rvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgriftageakslglidr lvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpeaqslflngfanedf kegyrafldkrpakftyr
Timeline for d4olqc_: