Lineage for d4ntyc_ (4nty C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2733543Family a.133.1.0: automated matches [194891] (1 protein)
    not a true family
  6. 2733544Protein automated matches [194892] (2 species)
    not a true protein
  7. 2733545Species Micrurus tener [TaxId:1114302] [237091] (3 PDB entries)
  8. 2733548Domain d4ntyc_: 4nty C: [237691]
    Other proteins in same PDB: d4ntyb_
    automated match to d4ntxc_
    complexed with cl, cs, pe4

Details for d4ntyc_

PDB Entry: 4nty (more details), 2.65 Å

PDB Description: cesium sites in the crystal structure of acid-sensing ion channel in complex with snake toxin
PDB Compounds: (C:) Basic phospholipase A2 homolog Tx-beta

SCOPe Domain Sequences for d4ntyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ntyc_ a.133.1.0 (C:) automated matches {Micrurus tener [TaxId: 1114302]}
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc

SCOPe Domain Coordinates for d4ntyc_:

Click to download the PDB-style file with coordinates for d4ntyc_.
(The format of our PDB-style files is described here.)

Timeline for d4ntyc_: