Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (14 species) not a true protein |
Species Micrurus tener [TaxId:1114302] [237085] (3 PDB entries) |
Domain d4ntyb_: 4nty B: [237688] Other proteins in same PDB: d4ntyc_ automated match to d4ntxb_ complexed with cl, cs, pe4 |
PDB Entry: 4nty (more details), 2.65 Å
SCOPe Domain Sequences for d4ntyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ntyb_ g.8.1.0 (B:) automated matches {Micrurus tener [TaxId: 1114302]} eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg
Timeline for d4ntyb_: