SCOPe 2.04: Domain d4nqua2: 4nqu A:342-444

Lineage for d4nqua2 (4nqu A:342-444)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4nqua2: 4nqu A:342-444 [237682]
   automated match to d1igtb4
   complexed with so4

Details for d4nqua2

PDB Entry: 4nqu, 2.5 Å

PDB Description: anti-parallel Fc-knob (T366W) homodimer

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4nqua2:

Sequence; same for both SEQRES and ATOM records:

>d4nqua2 b.1.1.0 (A:342-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvslwclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d4nqua2:

• d4nqua2 first appeared in SCOPe 2.03
  
• d4nqua2 appears in SCOPe 2.05
  
• d4nqua2 appears in the current release, SCOPe 2.08