Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (24 families) |
Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63610] (44 PDB entries) Uniprot P09960 |
Domain d4ms6a3: 4ms6 A:461-610 [237660] Other proteins in same PDB: d4ms6a1, d4ms6a2 automated match to d2vj8a1 complexed with 28t, acy, yb, zn |
PDB Entry: 4ms6 (more details), 1.72 Å
SCOPe Domain Sequences for d4ms6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ms6a3 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d4ms6a3: