Lineage for d4m7ga_ (4m7g A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1320532Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1320533Protein automated matches [190438] (15 species)
    not a true protein
  7. 1320612Species Saccharopolyspora erythraea [TaxId:1836] [237652] (1 PDB entry)
  8. 1320613Domain d4m7ga_: 4m7g A: [237653]
    automated match to d3h7tb_

Details for d4m7ga_

PDB Entry: 4m7g (more details), 0.81 Å

PDB Description: Streptomyces Erythraeus Trypsin
PDB Compounds: (A:) Trypsin-like protease

SCOPe Domain Sequences for d4m7ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m7ga_ b.47.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv
mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat
ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpdamvcagvpeggvdtcqgdsg
gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqin

SCOPe Domain Coordinates for d4m7ga_:

Click to download the PDB-style file with coordinates for d4m7ga_.
(The format of our PDB-style files is described here.)

Timeline for d4m7ga_: