Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (15 species) not a true protein |
Species Saccharopolyspora erythraea [TaxId:1836] [237652] (1 PDB entry) |
Domain d4m7ga_: 4m7g A: [237653] automated match to d3h7tb_ |
PDB Entry: 4m7g (more details), 0.81 Å
SCOPe Domain Sequences for d4m7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m7ga_ b.47.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]} ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpdamvcagvpeggvdtcqgdsg gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqin
Timeline for d4m7ga_: