Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (31 species) not a true protein |
Species Glycine max [TaxId:3847] [237649] (1 PDB entry) |
Domain d4mafa2: 4maf A:219-449 [237650] Other proteins in same PDB: d4mafa1, d4mafc1 automated match to d1g8fa2 complexed with adx |
PDB Entry: 4maf (more details), 2.48 Å
SCOPe Domain Sequences for d4mafa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mafa2 c.26.1.0 (A:219-449) automated matches {Glycine max [TaxId: 3847]} gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydslv
Timeline for d4mafa2: